PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00004483001
Common NameGSBRNA2T00004483001, LOC106397144
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 423aa    MW: 47150.7 Da    PI: 5.782
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00004483001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.52.3e-31220274155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr+rWtpeLHe+F++ v++L G+ekAtPk++l+lm+v+gLt++hvkSHLQkYRl
  GSBRNA2T00004483001 220 KPRMRWTPELHESFLKSVDKLEGPEKATPKAVLKLMNVEGLTIYHVKSHLQKYRL 274
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.002217277IPR017930Myb domain
SuperFamilySSF466891.25E-16219275IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-29219275IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-24220275IPR006447Myb domain, plants
PfamPF002495.9E-8222273IPR001005SANT/Myb domain
PfamPF143792.5E-22310357IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MNSHRLVSTA QEECNKGIHQ PCSSSLSPVH NFLNLQPENR KSPVNKGTFS RSSTFCTNLY  60
ISSSSTSEAQ KHLGNTLPFL PDPSTNIQPA SCVESARSPS IFSEDMSNPL DGDTTLVKDF  120
FNLSGDACSD GAFHDLDCSN DSYCLSDQME LQFLSDELEL AITDRSETPR LDEIYETPLA  180
SSSNPVTGLS QSQRSLSGAV SIEAVSSHPS PGSVAAYNHK PRMRWTPELH ESFLKSVDKL  240
EGPEKATPKA VLKLMNVEGL TIYHVKSHLQ KYRLAKHIPE KKEEKKNVNT EEKKLALSNS  300
EAVERKKGAM QLTEALRMQM EVQKQLHEQL EVQRVLQLRI EEHAKYLEKM LEEQRKTGML  360
MSSSSSSSQT LLSDCQNMSK TEVSSLSQPK NIASETEDDK CESPQKRRRV ENNTESEDPP  420
ER*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1405409KRRRV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.229985e-34leaf| root| vegetative meristem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013693159.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLA0A078IR270.0A0A078IR27_BRANA; BnaC03g73670D protein
STRINGBra039364.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67862744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.20.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]